LL-37 10MG
Regular price
$55.00
Shipping calculated at checkout.
LL-37 has been shown to have antimicrobial activity against multiple Gram-positive and Gram-negative human pathogens. Antimicrobial peptides (AMPs) have the potential to serve as an alternative to antibiotics. It's simple, AMPs kill the microbial pathogens (the bugs). AMPs can possibly regulate bacteria/virus invasion and may control infection. It has been reported that AMPs could be used to activate the innate mucosal immune response in order to get rid of the infections. (Mucosal refers to the immune response at mucosal membranes of the intestines, the urogenital tract and the respiratory system, i.e., surfaces that are in contact with the external environment).
In vitro and in vivo wound healing-promoting activities of human cathelicidin LL-37
J. Invest. Dermatol.
(2008)
Sequence: [LL-37, 37 aa]
FOR RESEARCH PURPOSES ONLY